life science research products, biological research products, biotechnology
Use * as wildcard:
iclines
RNAStorm
Pluripro

OD1

OD1
print page
Size: 100 µg
$350.00
Add to basket
Catalogue number:
ODX001-00100
Name:
OD1
Supplier:
Availability:

OD1 is a scorpion peptide that has been isolated initially from the venom of the scorpion Odonthobuthus doriae. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7 (EC50 4.5 nM), Nav1.4 (EC50 10 ± 2 nM) and Nav1.6 (EC50 47 ± 10 nM). OD1 also blocks fast inactivation of the para/tipE insect channel (EC50 80 nM). OD1 weakly affects mammalian Nav1.3 and Nav1.5 (EC50 > 1 μM) and does not affect Nav1.2 and Nav1.8. OD1 induces spontaneous pain when injected in animal in association with our without Veratridine and can be used to test the analgesic effects of Nav1.7 blockers in-vivo.

Applications:


Potent Nav1.7 channel activator

Product Type:
Peptides & proteins
Storage Temp:
RT
Molecular Weight:
7206.20 Da
Reference:
1) Jalali A., et al. (2005) OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels. FEBS. PMID: 16038905.; 2) Maertens C., et al. (2006) Potent Modulation of the Voltage-Gated Sodium Channel Nav1.7 by OD1, a Toxin from the Scorpion Odonthobuthus doriae. Mol. Pharmacol. PMID: 16641312.; 3) Durek T., et al. (2013) Chemical Engineering and Structural and Pharmacological Characterization of the α‑Scorpion Toxin OD1. ACS. PIMD: 3527544.
Additional Information:
AA sequence: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2; Disulfide bonds: C13-C64 ; C17-C37 ; C23-C47 ; C27-C49