www.mayflowerbio.com
Sales & Support: 314-485-5210

*

IL-27/IL-35 (EBI-3)

Catalogue number:
GFH162-20
Size:
20 μg
Product is available in:
  • USA
  • Canada
$170.00 Shipping is calculated in checkout

Epstein-Barr Virus Induced Gene-3 (EBI-3) is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI-3 is a non-glycosylated polypeptide chain.

Product Type:

Peptides & proteins

Alternative Names:

IL-35/EBI3, IL-27/EBI3

Limit of Detection:

23.4 kDa

Storage Temperature:

-20°C

Additional Information:

NAME: Epstein-Barr Virus Induced Gene-3; ACCESSION/UNIPROT#: Q14213; EXPRESSION SYSTEM: E.coli; FORMAT: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) + 0.5% mannitol. Reconstitute in sterile 20 mM HCI at 0.1 mg/mL.; #AA: 210; SEQUENCE: MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPY VLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEAT SFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Related Content: