life science research products, biological research products, biotechnology
Use * as wildcard:
Pluripro
PODS Growth Factors
iclines

IL-27/IL-35 (EBI-3)

IL-27/IL-35 (EBI-3)
print page
Size: 1 mg
$5240.00
Add to basket
Catalogue number:
GFH162-1000
Name:
IL-27/IL-35 (EBI-3)
Supplier:
Availability:

Epstein-Barr Virus Induced Gene-3 (EBI-3) is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity. Recombinant Human EBI-3 is a non-glycosylated polypeptide chain.

Product Type:
Peptides & proteins
Alternative Names:
IL-35/EBI3, IL-27/EBI3
Storage Temp:
-20°C
Limit of Detection:
23.4 kDa
Specifications:
PURITY (MIN.): ≥90
Additional Information:
NAME: Epstein-Barr Virus Induced Gene-3; ACCESSION/UNIPROT#: Q14213; EXPRESSION SYSTEM: E.coli; FORMAT: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) + 0.5% mannitol. Reconstitute in sterile 20 mM HCI at 0.1 mg/mL.; #AA: 210; SEQUENCE: MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPY VLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEAT SFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK