www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Tf2 scorpion toxin

Catalogue number:
TFX001-00100
Size:
100 µg
Product is available in:
  • USA
  • Canada
$225.00 Shipping is calculated in checkout

Tf2 is a potent Nav1.3 activator. Tf2 was originally isolated from the venom of the Brazilian scorpion Tityus fasciolatus. This β-scorpion peptide toxin has been described potently potentiate Nav1.3 opening at 1µm without affecting other Nav isorforms.

Product Type:

Peptides & proteins

Reference:

Camargos T., et al. (2015) doi: 10.1371/journal.pone.0128578 , PMID: 26083731

Limit of Detection:

6953.86

Additional Information:

AA Sequence: KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC-NH2. Disulfide bonds between Cys1-Cys8, Cys2-Cys5, Cys3-Cys6 and Cys4-Cys7.