www.mayflowerbio.com
Sales & Support: 314-485-5210

*

U2-sicaritoxin-Li1a

Catalogue number:
LIX001-00500
Size:
500 µg
Product is available in:
  • USA
  • Canada
$1531.00 Shipping is calculated in checkout

U2-sicaritoxin-Li1a is a potential insecticidal peptide. U2-sicaritoxin-Li1a (LiTx3) has been isolated from the venom of Loxosceles intermedia spider. U2-sicaritoxin-Li1a has been described as a potential insecticidal peptide active against Spodoptera frugiperda (Lepdoptera: Noctuidade).

Product Type:

Peptides & proteins

Reference:

Soares de Castro C., et al. (2004) Identification and molecular cloning of insecticidal toxins from the venom of the brown spider Loxosceles intermedia. Toxicon. PMID: 15302533

Limit of Detection:

5638.4

Additional Information:

AA Sequence: GCIKYGDRCGSPHGLPSNCCNDWKYKGRCGCTMGVCTCGPNCPSRGCDWSKKG. 5 disulfide bonds