Bovine IL-1 beta Biotinylated Recombinant Protein
The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251). For research use only. Made in the USA
Peptides & proteins
IL-1F2
-20 C
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Bovine


