Chicken IL-2 Biotinylated Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RPB1819C-010
Size:
10 µg
Product is available in:
The Chicken IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 Biotinylated applications are for cell culture. Chicken IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Biotinylated Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA
Product Type:
Peptides & proteins
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Chicken


