Mouse APRIL Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RP0360M-500
Size:
500 µg (5 X 100 µg)
Product is available in:
The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 69583). For research use only. Made in the USA
Product Type:
Peptides & proteins
Alternative Names:
TNFSF13
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Mouse


