Chicken IL-2 Recombinant Protein
                            Supplier:
                        
                        
                            Kingfisher Biotech                        
                    
                            Catalogue number:
                        
                        
                            RP0063C-100
                        
                    
                            Size:
                        
                        
                            100 µg
                        
                    
                            Product is available in:
                        
                        The Chicken IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958). For research use only. Made in the USA
Product Type:
    Peptides & proteins
Storage Temperature:
    -20 C
Additional Information:
    SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Chicken


