www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Bovine IL-36RA Recombinant Protein

Supplier:
Kingfisher Biotech
Catalogue number:
RP0076B-005
Size:
5 µg
Product is available in:
  • USA
  • Canada
$160.00 Shipping is calculated in checkout

The Bovine IL-36 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-36 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514). For research use only. Made in the USA

Product Type:

Peptides & proteins

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Bovine, Zebu