Bovine IL-17A Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RP0056B-025
Size:
25 µg
Product is available in:
The Bovine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: (KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA) (Gene ID: 282863). For research use only. Made in the USA
Product Type:
Peptides & proteins
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Bovine, Zebu