Equine IL-13 Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RP0102E-025
Size:
25 µg
Product is available in:
The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA
Product Type:
Peptides & proteins
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Equine


