Mouse IL-10 Recombinant Protein

The Mouse IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse IL-10 Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS (160)) (Gene ID: 16153). For research use only. Made in the USA