Feline IL-1 alpha Recombinant Protein
The Feline IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-1 alpha Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence: SVAPNFYSSEKYNYQKIIKSQFILNDNLSQSVIRKAGGKYLAAAALQNLDDAVKFDMGAYTSKEDSKLPVTLRISKTRLFVSAQNEDEPVLLKEMPETPKTIRDETNLLFFWERHGSKNYFKSVAHPKLFIATQEEQLVHMARGLPSVTDFQILETQS (158)) (Gene ID: 493944). For research use only. Made in the USA
Peptides & proteins
IL-1F1
-20 C
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Feline


