Bovine CXCL10 Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RP0079B-005
Size:
5 µg
Product is available in:
The Bovine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL10 Specifications: (Molecular Weight: 9.3 kDa) (Amino Acid Sequence: VPLSRNTRCSCIEISNGSVNPRSLEKLEVIPASQSCPRVEIIATMKKNGEKRCLNPESKTIKNLLKAINKQRTKRSPRTRKEA) (Gene ID: 615107). For research use only. Made in the USA
Product Type:
Peptides & proteins
Alternative Names:
IP-10
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Bovine, Bison, Yak, Zebu