www.mayflowerbio.com
Sales & Support: 314-485-5210

*

Bovine CCL5 Recombinant Protein

Supplier:
Kingfisher Biotech
Catalogue number:
RP0062B-005
Size:
5 µg
Product is available in:
  • USA
  • Canada
$160.00 Shipping is calculated in checkout

The Bovine CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL5 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: SPYASDTTPCCFAYISRPLPRTHVQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINALELS) (Gene ID: 327712). For research use only. Made in the USA

Product Type:

Peptides & proteins

Alternative Names:

RANTES

Storage Temperature:

-20 C

Additional Information:

SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Bovine, Water Buffalo