Swine CCL4 Recombinant Protein
Supplier:
Kingfisher Biotech
Catalogue number:
RP0069S-100
Size:
100 µg
Product is available in:
The Swine CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTSCCFTYTVRKLPRNFVTDYYETSSLCSQPAVVFQTKKGRQVCANPSDDWVQEYMDDLELN) (Gene ID: 396668). For research use only. Made in the USA
Product Type:
Peptides & proteins
Alternative Names:
MIP-1 beta
Storage Temperature:
-20 C
Additional Information:
SOURCE: Yeast; PURITY: 98%; FORM: Lyophilized; 100% HOMOLOGY: Swine