life science research products, biological research products, biotechnology
Use * as wildcard:


print page
Size: 100 µg
Add to basket
Catalogue number:

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of voltage-dependent Nav and Kv channels. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.


Cell-penetrating peptide and voltage-dependent Nav and Kv channel blocker

Product Type:
Peptides & proteins
Storage Temp:
Molecular Weight:
4883.82 Da
1) Hayashi MA., et al. (2012) Crotamine: a novel cell-penetrating polypeptide nanocarrier with potential anti-cancer and biotechnological applications. Methods Mol Biol. PMID: 22791447; 2)De Lucca FL., et al. (1974) Characterization of ribonucleic acids from the venom glands of Crotalus durissus terrifucus (Ophidia, Reptilia) after manual extraction of the venom. Studies on template activity and base composition. Biochem J. PMID: 4463939.
Additional Information:
AA sequence: YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH; Disulfide bridges: Cys4-Cys36; Cys11-Cys30; Cys18-Cys37